A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10268
Swiss-prot Accession number	P87384 (Sequence in FASTA format)
Description	Somatostatin 1 precursor (PSS1) [Contains: Somatostatin-14 (S-I)(SSS1)].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	115 Amino acids
Molecular weight	12691
References	1  PubMed abstract 8901629 2  PubMed abstract 1358069
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (102-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10273
Swiss-prot Accession number	P87385 (Sequence in FASTA format)
Description	Somatostatin 2 precursor (PSS2) [Contains: [Pro2,Met13]-somatostatin-14 (S-2) (SS2)].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	103 Amino acids
Molecular weight	11648
References	1  PubMed abstract 8901629 2  PubMed abstract 1358069
Domain Name	Somatostatin
Hormone Name	[Pro2,Met13]-somatostatin-14
Mature Hormone Sequence	APCKNFFWKTFTMC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (90-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10664
Swiss-prot Accession number	Q09169 (Sequence in FASTA format)
Description	Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Primary role of GRF is to release GH from the pituitary
Protein Length	171 Amino acids
Molecular weight	19680
References	1  PubMed abstract 10813784 2  PubMed abstract 1720095
Domain Name	Hormone_2
Hormone Name	Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH)
Mature Hormone Sequence	HADDLLNKAYRNLLGQLSARKYLHTLMAKHLGAVSSSLEDDSEPLS
Position of mature hormone in Pre-Hormone protein	46 Residues from position (79-124)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10665
Swiss-prot Accession number	Q09169 (Sequence in FASTA format)
Description	Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator. Stimulates adenylate cyclase in pituitary cells
Protein Length	171 Amino acids
Molecular weight	19680
References	1  PubMed abstract 10813784 2  PubMed abstract 1720095
Domain Name	Hormone_2
Hormone Name	Pituitary adenylate cyclase-activating polypeptide 38
Mature Hormone Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK
Position of mature hormone in Pre-Hormone protein	38 Residues from position (127-164)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10666
Swiss-prot Accession number	Q09169 (Sequence in FASTA format)
Description	Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator. Stimulates adenylate cyclase in pituitary cells
Protein Length	171 Amino acids
Molecular weight	19680
References	1  PubMed abstract 10813784 2  PubMed abstract 1720095
Domain Name	Hormone_2
Hormone Name	Pituitary adenylate cyclase-activating polypeptide 27
Mature Hormone Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVL
Position of mature hormone in Pre-Hormone protein	27 Residues from position (127-153)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10959
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMSHFRWNKF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (76-86)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10960
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLEL
Position of mature hormone in Pre-Hormone protein	39 Residues from position (141-179)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10961
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (141-153)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10962
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	79 Residues from position (182-260)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10963
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKD
Position of mature hormone in Pre-Hormone protein	46 Residues from position (182-227)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10964
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DRKYKMHHFRWEGPPKD
Position of mature hormone in Pre-Hormone protein	17 Residues from position (211-227)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10965
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (230-260)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10966
Swiss-prot Accession number	P22923 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana ridibunda (Laughing frog) (Marsh frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	260 Amino acids
Molecular weight	30068
References	1  PubMed abstract 2260977 2  PubMed abstract 2260977
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (230-234)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated